PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.20129s0304.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family BES1
Protein Properties Length: 326aa    MW: 34705.5 Da    PI: 7.3048
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.20129s0304.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822219.29.5e-6821441149
                DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasas 89 
                           ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++p e++e++g+sa+as
  Bostr.20129s0304.1.p   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCRPVERMEIGGASATAS 90 
                           5899************************************************************************************* PP

                DUF822  90 pesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                           p+ss+q        +sp++sy++sp+ss+f+sp+s+++++l+s   +sl+p+l++ls++sss
  Bostr.20129s0304.1.p  91 PCSSYQ--------PSPCASYNPSPASSNFMSPASSSFANLTSGdgQSLIPWLKHLSTTSSS 144
                           ******........**********************9999998788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.2E-653139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCRPVERM EIGGASATAS PCSSYQPSPC ASYNPSPASS NFMSPASSSF  120
ANLTSGDGQS LIPWLKHLST TSSSSASSSS RLPNYLYIPG GSISAPVTPP LSSPTARTPR  180
MNPDWQQLNN SFFVSSTPPS PTRQIIPDSE WFSGIQLAQS VPASPTFSLV SQNPFGFKEE  240
AAASAAGGGG GSRMWTPGQS GTCSPAIPPG ADQTADVPMS EAVAPPEFAF GSNTNGLVKA  300
WEGERIHEES GSDDLELTLG NSSTR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0504300.0AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0903310.0AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417476.10.0PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV880.0BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLD7KVU20.0D7KVU2_ARALL; Putative uncharacterized protein
TrEMBLV4K8A20.0V4K8A2_EUTSA; Uncharacterized protein
STRINGAT1G78700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-175BES1/BZR1 homolog 4